General Information

  • ID:  hor000306
  • Uniprot ID:  A0A2P8YBG2
  • Protein name:  BLAST-3
  • Gene name:  ALLS
  • Organism:  Blattella germanica (German cockroach) (Blatta germanica)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Blattella (genus), Blattellinae (subfamily), Ectobiidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AGSDGRLYSFGL
  • Length:  12
  • Propeptide:  MLIATFFNEKPMPGPRTCYSLQAALVLSLLLKLSSSAFATTTSAGTHAVQEESSAGGGAEILPRLEELADNSELDLVKRLYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSKMYGFGLGKRAGSDGRLYSFGLGKRDYDDYYGDDDEEDHQTSADEDIEDADSVDLMDKRDRLYSFGLGKRARPYSFGLGKRAPSSAQRLYGFGLGKRALYSFGLGKRAGGRLYSFGLGKRPVNSGRQSGSRFNFGLGKRSDDFDI
  • Signal peptide:  MLIATFFNEKPMPGPRTCYSLQAALVLSLLLKLSSSAFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibited in vitro juvenile hormone production by corpora allata from virgin females of B. germanica.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A2P8YBG2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000306_AF2.pdbhor000306_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 143874 Formula: C55H83N15O18
Absent amino acids: CEHIKMNPQTVW Common amino acids: G
pI: 6.34 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: 0.83 Boman Index: -1313
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 73.33
Instability Index: 916.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 135.45

Literature

  • PubMed ID:  7846299
  • Title:  Allatostatic Neuropeptides From the Cockroach Blattella Germanica (L.) (Dictyoptera, Blattellidae). Identification, Immunolocalization and Activity